PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN45880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 646aa    MW: 71744.7 Da    PI: 5.2771
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN45880.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-093994361954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  KHN45880.1 399 FEHflHPYPKDSEKIMLARQTGLTRNQVANWFINARVR 436
                 665559******************************88 PP

2BELL125.61.9e-40270341172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erq l  kk+kLls+l+eVdkrY+qy++q+q+v+ssF++vag+g+a+pYt+lAl++iSrhFrcL+dai++qi
  KHN45880.1 270 ERQTLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMVAGCGAAEPYTTLALRTISRHFRCLRDAISGQI 341
                 6888999****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.5E-61189339IPR006563POX domain
PfamPF075262.9E-50195338IPR006563POX domain
PROSITE profilePS5007112.438377440IPR001356Homeobox domain
SMARTSM003891.6E-9380444IPR001356Homeobox domain
CDDcd000861.25E-12380441No hitNo description
SuperFamilySSF466892.35E-17381447IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28383446IPR009057Homeodomain-like
PfamPF059203.1E-17397436IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MYPNQAFSLG SYAEMMSGTS LFPHDYSETV GGGQNEVKFI TAMGETVTMH SINGHSNAAS  60
GDPACNSFAG DSHVVSRTQM GMVDSEQNIN CQGLSLSLGT LMPSNASVSP FQYQYHDTGL  120
LPLMNDFPNI KGTMSLKDDE ANNLHGEFRS VECMASVSSG GFHDMIKKEG FYNPNHPSMC  180
LKEVPSDLPG YSNSILNSQY LKAAQELLDE IVSVQKALKQ SGMEKQENNR DIGLDGSKDA  240
DGKSTSQSMQ MSSAPNGSSA NASSDLSSAE RQTLLDKKTK LLSMLDEVDK RYRQYCHQMQ  300
IVVSSFDMVA GCGAAEPYTT LALRTISRHF RCLRDAISGQ IQVTQRSLGE QEGIPRLRYV  360
DQQLRQQKAL QQLGVMRQAW RPQRGLPESS VSILRAWLFE HFLHPYPKDS EKIMLARQTG  420
LTRNQVANWF INARVRLWKP MVEEMYKEEF GDSEMNCNLS SENNTVKGKR DDVQESDNIN  480
NNNNKWEESQ DNLVTVDSVQ VQPQAEMDRV VNVENVVMNS GTGKLQGDQN QQRLGLNNNN  540
NSSSNFYSIS TNENGGDGGL MGTSTHATYD LSELGNFTVG SHVSLALELR NCENDGFAMS  600
DDAIQKRRKQ TLSSSPETDL LDYHFTDSGK QQHRFGNPHL LHEFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16386443158Homeobox protein Meis1
4xrs_B1e-16386443158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523566.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_006577981.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_006577982.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9FWS91e-113BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A0B2SLL10.0A0A0B2SLL1_GLYSO; BEL1-like homeodomain protein 3
TrEMBLK7KHT40.0K7KHT4_SOYBN; Uncharacterized protein
STRINGGLYMA04G03150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-104BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]